<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4439 CA38050 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 88
2 AZT+DDC 70
3 3TC+D4T 15
4 3TC+D4T+IDV 22
5 3TC+D4T+NFV 94

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y       V35I, K43EQ, E44D, R83K, V118I, K122P, K166R, D177E, I178IM, R211RK  
>CA38050| codons 1-249
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEQDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPEMVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N L10F, N88D K20T, E35G, M36I, I62V, L63P, H69HN, A71V  
>CA10857| codons 1-99
PQITLWQRPFVTIKIGGQLTEALLDTGADNTVLEGINLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGNKVIGTVLVGPTPVNIIGRDLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005