<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1420 CA3805 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 59
2 DDC 71
3 D4T 25
4 D4T+ SQV 6
5 D4T+ 3TC+ SQV 3
6 D4T+ 3TC+ RTV+ NVP 23
7 D4T+ RTV+ 3TC+ IDV 13
8 D4T+ 3TC+ IDV 40
9 D4T+ NFV+ 3TC 17
10 D4T+ NFV+ 3TC+ SQV 11

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M G73S L10I, E35D, M36I, I62V, L63P, C67F, A71V, I72M  
>CA3805| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QVPIEIFGHKVMSTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y       K20R, K43N, K104KR, K122E, V179VI, G196E, E204K, Q207E, R211K  
>CA3804| codons 1-258
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELENEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIEQHRTKIEKLREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQ

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005