<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4742 CA38047 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 57
2 3TC+AZT+NVP 126
3 3TC+AZT+EFV 44
4 3TC+ABC+AZT+EFV 131
5 3TC+ABC+EFV 29

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70KR, L74I, M184V, T215F K219Q K103N, G190A K238T M16V, V35T, V60I, T69TN, R83K, D177DG, T200A, Q207E, L228Q, E248D, A272S, K277R, T286A, I293V, E297R  
>CA38047| codons 1-299
PISPIETVPVKLKPGVDGPKVKQWPLTEEKIKALTEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSNRWRKIVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPGIVI
YQYVDDLYVASDLEIGQHRAKIEELREHLLRWGFFTPDQKHQKEPPFQWMGYELHPDTWT
VQPIVLPDKDSWTVNDIQKLVGKLNWASQIYSGIKVRQLCKLLRGAKALTEVVPLTREA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    R41K, H69R  
>CA38046| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGRKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005