<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5540 CA38044 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC 21
2 3TC+D4T+NFV 69
3 DDI+EFV+IDV 75
4 APV+D4T+RTV 180

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54L, L90M L23LI, L33F, G73C L10LI, I62V, L63P, I64V, I66V, V77I, I93L  
>CA38044| codons 1-99
PQITLWQRPIVTIKIGGQLKEAILDTGADDTVFEEMNLPGRWKPKMIGGIGGFLKVRQYD
QVPVEVCGHKAICTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T215Y       V35VI, R83K, K173Q, I244IV, A272P, I293V  
>CA38045| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRQQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPVVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005