<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1825 CA38014 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 56
2 AZT+DDI 117
3 AZT+DDI+IDV 9
4 3TC+D4T+NFV 73
5 3TC+APV+D4T+NFV 75
6 ABC+APV+D4T+NFV 70
7 D4T+DDI+EFV+LPV+TDF 39
8 D4T+EFV+TDF 38

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54M, L90M L33F, Q58E, G73A L10I, L19LV, L63P, A71T, I72T, V77I, I93L  
>CA38014| codons 1-99
PQITLWQRPIVTIKIGGQVKEALLDTGADDTVFEEMNLPGRWKPKLIGGIGGFMKVREYD
QIPIEICGHKTTATVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K219R K103N, Y188L   K22N, E28A, K43Q, V118I, K122E, D123N, Q174R, Q207E, A272P, E291D  
>CA38015| codons 1-299
PISPIETVPVKLKPGMDGPKVNQWPLTAEKIKALVEICTELEQEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKRNPDIVI
YQYMDDLLVGSDLEIGQHRTKIEELREHLWRWGFYTPDRKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDVIPLTEEA

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005