<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1151 CA38010 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 209
2 AZT+DDC 61
3 D4T 44
4 3TC+AZT 26
5 3TC+AZT+SQV 13
6 3TC+D4T+IDV 13
7 None 40
8 3TC+D4T+RTV+SQV 50
9 Unknown 241

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35ED, R41K, I62V, L63P, A71AV, V77I, I93L  
>CA38010| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMNLPGKWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVIGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L T215C     T39TA, K43KN, V60I, G196E, Q207E, R211A, V245K, A272P, K277R, I293V  
>CA38011| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELENEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRTKIEELREHLLAWGFCTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005