<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8402 CA38006 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 91
2 3TC+AZT+IDV 174
3 DDI+EFV+LPV 39
4 DDI+EFV+LPV+TDF 87

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M L33F L10I, M36ML, I62V, L63P, A71AITV, I93L  
>CA38006| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVFEELNLPGRWKPKLIGGIGGFVKVRQYD
QVPIEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y   K103N   E6D, I142V, E203Q, Q207D, V241M, A272P, R284K, T286A, I293V  
>CA38007| codons 1-300
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIQELRDHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
MQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLKGAKALTEVVPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005