<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9839 CA37993 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 30
2 AZT+DDI+LPV 18
3 D4T+NVP+TDF 26
4 DDI+EFV+TDF 30

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R   K101E, Y181YC, G190A A98AG, V179VD V35T, K49R, K122E, D123DN, A158S, E169D, R211A, V245M, K277R, T286A, A288S, E297A  
>CA37993| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPV
FAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLEKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILDPFRKQNPDIDI
CQYMDDLYVASDLEIGQHRTKIEELRQHLLAWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKSLTEVIPLTAEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, L63P, A71T, V77I, I93L  
>CA37992| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKTIGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009