<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9801 CA37984 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 57
2 None 96
3 3TC+AZT+IDV 44
4 None 52
5 D4T+DDI+EFV+NFV 31
6 None 109
7 3TC+D4T+LPV 88

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54IV, L76V, I84IV L10FI T12TI, I13V, G16E, Q61H, I64V, I72RT, V77VI, T91TS  
>CA37984| codons 1-99
PQITLWQRPIVIVKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFVKVRQYD
HILVEICGHKATGTVVIGPTPVNVIGRNLLSQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       T69N, V118I, D121H, K122E, I135T, D177E, I178M, V179I, I202V, A272P, I293V  
>CA37985| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSNKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMII
YQYVDDLYVGSDLEIGQHRTKVEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005