<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1417 CA3798 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 26
2 AZT+ 3TC 26
3 NFV+ NVP+ DDC 78
4 SQV+ RTV 9

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R T215I, K219E Y181C V108I K11R, E53D, K122E, H221HY, V245E  
>CA3798| codons 1-255
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPDNPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFITPDEKYQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVN

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, I84V L10F, N88D L63P, I72IV  
>CA3799| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADNTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAVGTVLVGPTPVNVIGRDLLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: classification, amino acid mutation patterns, and prevalence in a Northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012