<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9697 CA37954 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 35
2 None 48
3 3TC+D4T+NFV 185
4 3TC+D4T+DDI+NFV+RTV+SQV+TDF 3
5 DDI+RTV+SQV+TDF 19

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M G73GS K20M, E35ED, M36I, L63P, I64IV, A71AV, I93L  
>CA37954| codons 1-99
PQITLWQRPLVTIKIGGQLMEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QIPVEICGHKVISTVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       K20KR, K32KR, D123E, K173Q, D177E, T200TA, R211K, F214L, V245KM, E248D, D250E, A272P, E297K  
>CA37955| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIRALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRQQNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTKEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005