<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1415 CA3795 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 83
2 AZT+DDI 30
3 DDC 91
4 3TC+AZT 52
5 3TC+AZT+IDV 83
6 D4T+NFV+NVP 26

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54A, V82A K43T L10I, E34Q, L63P, A71V, Q92K  
>CA3795| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLQEMNLPGRWTPKMIGGIGGFAKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLLTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215Y K219Q K101E, K103KN, Y181C   K20R, V35T, T39A, K122E, K166R, Q207E, A272P, T286A, I293V, E297T  
>CA3794| codons 1-302
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICAELEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
CQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGFYTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVVPLTTEAE
LE

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005