<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5111 CA37930 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 100
2 3TC+AZT 13
3 3TC+AZT+IDV 78
4 D4T+DDI+NVP 48
5 ABC+RTV+SQV 70
6 ABC+APV+AZT+RTV 104
7 3TC+AZT+LPV+SQV+TDF 65

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48L, I54T, V82A, I84V, L90M L33F, K43T, T74P L10I, I13V, K20R, E34Q, E35D, M36I, N37S, R41K, I62V, L63P, I64V, A71T, I93L  
>CA37930| codons 1-99
PQITLWQRPIVTVKIGGQLREALLDTGADDTVFQDISLPGKWTPKMILGIGGFTKVRQYD
QVPVEICGHKTIGPVLVGPTPANVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74I, T215F K219W Y181C V179D P4S, V35I, T39E, V60I, I135IR, A158S, S162C, G196E, T200TA, Q207A, H208HY, R211K, D218E, L228H, V245K, A272P, L283I, I293V  
>CA37931| codons 1-300
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICEELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPSIFQCSMTKILEPFRKQNPDIDI
CQYMDDLYVGSDLEIEQHRAKIEELRAYLLKWGFFTPEWKHQKEPPFHWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGTKALTEVVPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005