<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1869 CA37924 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 72
2 D4T+DLV+RTV+SQV 9
3 3TC+AZT+IDV 56
4 D4T+EFV+NFV 37
5 ABC+APV+D4T 18
6 None 50
7 3TC+APV+AZT+EFV+LPV 24
8 3TC+AZT+EFV+LPV 18
9 None 61
10 3TC+TDF 13
11 3TC+ABC+APV+EFV+TDF 15

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54IV, V82A L24LI L10LI, I15V, L19LI, R41K, L63LP, T74S, V77VI  
>CA37924| codons 1-99
PQITLWQRPIVTIKVGGQIKEALIDTGADDTVLEEMNLPGKWKPKLIGGIGGFVKVRQYD
QIPIEICGHKAIGSVLIGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, T215Y   K101E, Y181C, G190S A98G S3C, K20R, V35I, E44D, R83K, V111I, V118I, I142V, K166R, I167V, T200A, I202V, E203D, H208Y, L210S, R211K, H221Y, V245T, E248D, D250E, A272P, K277R, I293V, E297T  
>CA37925| codons 1-300
PICPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKKTQDFWEVQLGIPHPGGLEKKKSVTVLDIGDAYFSIPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTRVLEPFRKQNPDIVI
CQYVDDLYVSSDLEIGQHRAKVDELRQYLSKWGFYTPDKKYQKEPPFLWMGYELHPDKWT
VQPITLPDKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTTEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005