<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6437 CA37914 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+3TC 108
2 3TC+AZT+SQV 34
3 DDC+DLV+NFV 134
4 ABC+D4T+IDV+RTV 122
5 3TC+ABC+EFV 34

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y V75M, K219N K101E, Y181C, G190S A98G K11KT, V35M, K43N, E44D, V118I, D123E, D177E, E203D, Q207E, H208Y, R211K, L228H, A272P  
>CA37914| codons 1-300
PISPIETVPVTLKPGMDGPKVKQWPLTEEKIKALMEICTELENDGKISKIGPENPYNTPV
FAIKKKDSTKWRKLMDFRELNKRTQDFWEVQLGIPHPGGLEKKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
CQYVDDLYVSSDLEIGQHRTKIDELREYLWKWGFYTPDNKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M G73T L10I, L24F, N37C, K45R, K55R, R57K, L63P, A71V, I72T, V77I, I93L  
>CA37913| codons 1-99
PQITLWQRPIVTIKIGGQLKEALFDTGADDTVLEEMCLPGRWKPRIIGGIGGFIRVKQYD
QIPIEICGHKVTTTVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012