<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1860 CA37911 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 209
2 3TC+AZT+IDV 58
3 D4T+DDI+RTV+SQV 36
4 3TC+D4T+DDI+EFV 90
5 3TC+ABC+AZT+DDI 46
6 None 43
7 DDI+EFV+LPV+TDF 64

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M   L10I, I13V, K14R, R41K, K55R, L63P, A71V  
>CA37911| codons 1-99
PQITLWQRPIVTVRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKLIGGIGGFVRVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, L74I, M184I, T215F K219Q G190E A98G K20R, V35E, T39A, V60I, K101R, K103R, V118I, K122E, I135K, F214L, L228H, V245A, I293V, E297K  
>CA37912| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALEEICAELEKEGKISKIGPENPYNTPI
FAIKKKNSDRWRKIVDFRELNKRTQDFWEVQLGIPHPGGLRKRKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSKNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYIDDLYVESDLEIGQHRTKIEELRQHLLRWGLFTPDQKHQKEPPFHWMGYELHPDKWT
VQPIALPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTKEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005