<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1556 CA37910 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 109
2 AZT+DDC 14
3 DDI 27
4 D4T 21
5 3TC+AZT 58
6 3TC+AZT+IDV 48
7 D4T+NFV 25
8 DDC+NFV+RTV+SQV 16
9 3TC+RTV+SQV 5
10 ABC+EFV+RTV+SQV 44
11 ABC+APV+D4T+RTV 37
12 3TC+EFV+NVP 15
13 3TC+EFV+LPV+NVP 56
14 APV+D4T+DDI+IDV 49
15 EFV+NVP+TDF 65
16 3TC+ABC+AZT+LPV+SQV+TDF 1

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69A_SG, L74V, L210W, T215CY A62V, D67E L100I, K103N   K64R, V111I, K122E, I135T, S162Y, E169A, I178L, H208L, R211K, D218DE, H221HY, L228H, V245E, A272P  
>CA37910| codons 1-274
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FVIRKKESAKWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDIGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILAPFRKQNPDLVI
YQYMDDLYVGSDLEIGQHRTKIEELRQLLWKWGFYTPEKKYQKEPPFHWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGI

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I84V, L90M L10F, V11I, L33F, G73S, L89V T12S, I13V, I15V, L19P, K20T, E35G, M36I, I62V, L63P, A71I, P79A K70AE
>CA37909| codons 1-99
PQITLWQRPFISVKVGGQPTEALLDTGADDTIFEGINLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHEIISTVLVGATPVNVIGRNVMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005