<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3932 CA37882 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDC 60
2 3TC+ D4T+ RTV 30
3 3TC+ DDI+ RTV+ SQV 17
4 3TC+ AZT+ NVP 43
5 DDI+ D4T+ DLV+ NFV 50
6 NFV+ ABC+ ADV+ EFV 45
7 APV+ ABC+ EFV 18
8 Unknown 1

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I50IV, I54V, V82T, L90M F53FL L10I, I15V, K20R, E35D, M36I, N37E, L63P, A71AV  
>CA37882| codons 1-98
PQITLWQRPIVTIKVGGQLREALLDTGADDTVLEDIELPGRWKPKIIGGVGGLVKVRQYD
QIPIEICGHKVIGTVLVGPTPTNIIGRNLMTQIGCTLN

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005