<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA622 CA37880 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 18
2 AZT+DDC 4
3 AZT+DDI 13
4 3TC+AZT 44
5 3TC+D4T+IDV 22
6 D4T+DDI+IDV 32
7 3TC+D4T+RTV+SQV 58
8 ADV+EFV+RTV+SQV 104
9 ABC+D4T+LPV+TDF 171

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82T, I84V, L90M L10F, L33F, G73S, L89V V11L, G16A, L19I, R41K, L63P, A71V, T91S, I93L  
>CA37880| codons 1-99
PQITLWQRPFLTIKIAGQIKEALLDTGADDTVFEEMNLPGKWKPKIIGGIGGFVKVRQYD
QIPIEICGHKVISTVLVGPTPTNVIGRNVMSQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L210W, T215Y V75VA, K219E   F227L V35I, T39A, E44D, A98AS, L109I, V118I, K122E, V189VI, I202V, H208Y, R211K, D218E, H221HY, L228H, I257L, I293V, E297K  
>CA37881| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAELEKDGKISKIGPENPYNTPV
FAIKKKNSTRWRKLADFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVIDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYIGSDLEIGQHRTKVEELRQYLWKWGFYTPEEKYQKEPPLHWMGYELHPDKWT
VQPIVLPEKDSWTVNDLQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTKEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005