<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4022 CA37873 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 26
2 3TC+AZT+RTV 31
3 D4T+IDV+NVP 109
4 3TC+APV+D4T 223

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, V75VIM, M184V, L210W, T215Y     A98G V35KM, T39TA, K43N, E44ED, E53EQ, P55PS, V60VI, S68SG, V118I, K122E, I135T, G196GE, E203K, Q207E, H208HY, R211K, K223KE, A272P, I293V  
>CA37873| codons 1-299
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAELENDGKISKIGPQNSYNTPI
FAIKKKNGTKWRKLMDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIKELREYLWKWGFYTPDKKHQEEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I50V, I54V, V82VA L33F L10I, I13IV, K20R, E35D, M36I, N37D, I62V, L63P, A71V, I72V  
>CA37872| codons 1-99
PQITLWQRPIVTVKIGGQLREALLDTGADDTVFEDIDLPGRWKPKMIGGVGGFVKVRQYD
QVPIEICGHKVVGTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005