<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1549 CA37864 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 187
2 3TC+AZT 67
3 3TC+D4T+IDV 39
4 DDC+DLV+NFV+SQV 22
5 3TC+D4T+NFV+SQV 63
6 APV+D4T+EFV 43
7 3TC+APV+DDI+SQV 15
8 3TC+APV+DDI+DLV+NVP 25
9 APV+DDI+LPV 42
10 D4T+DDI+TDF 20
11 3TC+D4T+DDI+RTV+SQV+TDF 17
12 3TC+DDI+IDV+RTV+TDF 59

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L24I, L33F, K43T, G73S L10I, T12P, I13V, K20R, M36I, K55R, D60E, Q61DN, I62V, L63P, A71AV, I72IT  
>CA37864| codons 1-99
PQITLWQRPIVPVKIGGQLREALIDTGADDTVFEEINLPGRWTPKLIGGIGGFVRVRQYE
NVPIEICGHKVTSTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, L74V, M184V, L210W, T215Y K219R K103N, Y181C   V21I, T39A, K43E, E44A, A98S, V111I, V118I, K122E, I135T, K166KR, I178IL, V179IT, E203K, Q207E, H208Y, R211K, K223Q, L228R, Q242L, I257L, A272P, K277R, T286A, I293V  
>CA37865| codons 1-299
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALVEICAELEEAGKISKIGPENPYNTPV
FAIKKKDSDKWRKVVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDIGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDLTI
CQYVDDLYVGSDLEIGQHRTKIKELREYLWKWGFYTPDRKHQQEPPFRWMGYELHPDKWT
VLPIVLPEKDSWTVNDLQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVVPLTEEA

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009