<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5175 CA37858 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 161
2 3TC+AZT 44
3 3TC+AZT+IDV 126
4 DDI+RTV+SQV 193

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46L, I54V, V82A, L90M L23I, L33F, F53L I13V, K14R, K20R, M36I, L63P, I64V, A71V  
>CA37858| codons 1-99
PQITLWQRPLVTVRIGGQLREAILDTGADDTIFEEINLPGRWKPKLIGGIGGLVKVRQYD
QIPVEICGHKVIGTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R T215V, K219Q     V35VI, V60I, T69N, D121H, K122E, I135T, I178M, T200A, R211T, D218E, K277R, Q278E, I293V, E297R  
>CA37859| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLTWGFVTPEQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRELCKLLRGTKALTEVVPLTREAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005