<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8000 CA37850 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+3TC+IDV 52
2 3TC+D4T+NFV 13
3 3TC+D4T+NVP 243
4 None 17
5 3TC+ABC+EFV+TDF 32

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65KR, M184V A62V, V75VI K103N, Y181C V108I, K238T K32Q, D123E, I135R, K166R, D177E, T200TA, R211RG, F214L, H221Y, V245E, E248Q, A272P, T286TA, I293V  
>CA37850| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIQALVEICTEMEKEGKISKIGPENPYNTPV
FVIKRKDSTKWRKLIDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DKEFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPEIVI
CQYVDDLYVGSDLEIGQHRAKIEELRQHLLGWGLTTPDKKYQKEPPFLWMGYELHPDTWT
VQPIELPQKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVVPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, K20R, N37ND, R41RK, D60E, I64V, V77I, I85V, I93L  
>CA37849| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEEMDLPGKWKPKMIGGIGGFIKVRQYE
QILVEICGHKAIGTVLIGPTPVNIVGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005