<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8081 CA37838 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI 370

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R T215I, K219Q     K20R, V118I, K122E, D123N, I135T, F214L, L228H, V245M  
>CA37838| codons 1-251
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLITPDQKHQKEPPFHWMGYELHPDKWT
VQPIMLPEKDS

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    M36I, N37S, I62V, L63P, I93L  
>CA37837| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEISLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009