<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1502 CA37835 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI+RTV 35
2 3TC+D4T+NFV 187
3 Unknown 56

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M   L10I, I15V, L19I, K20R, L24F, M36I, R41K, L63P, A71V, I93L  
>CA37835| codons 1-99
PQITLWQRPIVTIKVGGQIREALFDTGADDTVLEEINLPGKWKPKLIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215CF K219Q K103N V108I K20R, V35M, V60I, K64R, K101S, K122P, I135T, D177E, I178L  
>CA37836| codons 1-259
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPI
FAIRKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLSKNKSVTILDVGDAYFSVPL
DPDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPELVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQK

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005