<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5551 CA37827 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 87
2 None 15
3 3TC+AZT+NFV+RTV 76
4 3TC+AZT+NFV 78

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, N88S, L90LM Q58E K20L, I62V, L63P, A71T, T74S, V77I  
>CA37827| codons 13-99
IKIGGQLLEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVREYDQVPIEICGHKTI
GSVLIGPTPVNIIGRSLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215F K219E     E28A, K32Q, V35I, D123E, I135T, I142V, I167IV, D177E, V179I, T200IM, I202V, H208HY, R211K, L228H, K277R, T286A, A288T, I293IV, E297A  
>CA37828| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTAEKIQALIEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKVLEPFRKQNPEIII
YQYVDDLYVGSDLEIGQHRMKVEELRQYLLKWGFFTPDEKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKTLTEVVPLTAEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005