<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1410 CA3782 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+DDC+DLV+NFV 26
2 D4T+DLV+NFV 19

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M G73T L10I, N37H, I62V, L63P, I64IV, I72IL, V77I, I93L  
>CA3782| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMHLPGRWKPKMIGGIGGFIKVRQYD
QVPVEICGHKALTTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, L74LI, T215F   Y181C   K20R, V35M, K43E, K103R, S162A, G196E, Q207QE, F214L, L228H K219L
>CA3781| codons 1-271
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICTELEEEGKISKIGPENPYNTPV
FAIKKKNSDRWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIEQHRTKIEELREHLLRWGLFTPDLKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIY

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001