<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6569 CA37819 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+Unknown 28
2 ABC+D4T+Unknown 9
3 3TC+D4T+Unknown 24
4 3TC+D4T+LPV 52
5 3TC+D4T+LPV+TDF 30
6 3TC+D4T+LPV+TDF 25

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L24I, L33LF L10I, E35ED, M36L, N37DE, L38W, P39PQ, I62V, L63P, A71V  
>CA37819| codons 1-99
PQITLWQRPIVTIKIGGQLKEALIDTGADDTVFEDLEWQGRWKPKLIGGIGGFVKVRQYD
QVPIEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y   K103N A98AG E6K, V35KR, T39D, E44ED, V60I, V118I, K122E, I135T, S162C, D177DG, E194ED, G196E, E203K, Q207E, H208HY, R211K, K223KE, L228H, Q242H, T286A, I293V  
>CA37820| codons 1-300
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALREICDELEKDGKISKIGPENPYNTPI
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPGIVI
YQYVDDLYVGSDLDIEQHRTKIKELREYLWKWGFYTPDKKHQEEPPFHWMGYELHPDKWT
VHPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005