<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1485 CA37814 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 74
2 D4T+DDC 31
3 3TC+AZT 9
4 3TC+AZT+IDV 31
5 AZT+DDI+IDV 22
6 3TC+DDI+NFV 17
7 None 61
8 D4T+DDI+SQV 22
9 AZT+EFV+SQV 48
10 ABC+AZT+EFV+SQV 165

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, T215F K219Q V106A V179D K20R, V35M, T39A, E40D, V90I, A98S, K103R, K104N, I135T, S162Y, R211Q, L228H, V245E, T286A, E297K  
>CA37814| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICADLEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEIQLGIPHPSGLKKRNSATVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIDI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLQWGFFTPDQKHQKEPPFHWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTKEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, K14R, L63A, I72V, V77I, I93L  
>CA37813| codons 1-99
PQITLWQRPIVTIRIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIAIEICGHKAVGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009