<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2251 CA37811 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+IDV 5
2 3TC+D4T+IDV 58
3 D4T+EFV+NFV 175
4 3TC+ABC+AZT+NFV 50

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I L23I, L76E L10I, I13V, E35D, N37D, Q61N, I62V, L63P, I64V, V77I  
>CA37811| codons 1-99
PQITLWQRPIVTVKIGGQLKEAILDTGADDTVLEDMDLPGRWKPKIIGGIGGFIKVRQYD
NVPVEICGHKAIGTVEIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70KR, M184V, T215F   K103N   K20R, V35T, I135V, S162C, R211K, V245T, K281R, I293V, P294T Y232H
>CA37812| codons 1-299
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFFTPDKKHQKEPPFLWMGHELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGTKALTEVVTLTEEA

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005