<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1333 CA37805 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T 26
2 3TC+D4T+SQV 35
3 3TC+D4T+IDV 13
4 3TC+D4T+NFV 71
5 3TC+D4T+RTV+SQV 35
6 D4T+DDI+EFV 14

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12N, L63P, I64V, A71T R41RG
>CA37805| codons 1-98
PQITLWQRPLVNIKIGGQLKEALLDTGADDTVLEEMNLPGGWKPKMIGGIGGFIKVRQYD
QIPVEICGHKTIGTVLVGPTPVNIIGRNLLTQIGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V       K20R, V60I, T69N, I142V, R211K, V245I  
>CA37806| codons 1-249
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIILPEK

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005