<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2193 CA37796 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 87
2 3TC+AZT 70
3 3TC+AZT+NFV 31
4 D4T+IDV+NVP 58
5 3TC+EFV+NFV+SQV 28
6 3TC+APV+AZT+EFV 26
7 APV+DDI+EFV+IDV 74
8 3TC+APV+D4T+LPV 107

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q     V60I, T69N, A98S, K122E, D123E, I135IT, I142IV, E194EQ, G196E, D218E, V245E, I293V  
>CA37796| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLQIEQHRTKIEELRQHLLRWGFTTPEQKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, V82VA, I84IV L24LI, Q58QE L10LI, R57RK, L63C, I64IV, V77VI T74TR
>CA37795| codons 1-99
PQITLWQRPIVTIKIGGQLKEALIDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVKEYD
QICVEICGHKAIGRVLIGPTPANVIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005