<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1408 CA3778 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 7
2 AZT 77
3 D4T+DDC 24
4 3TC+AZT+IDV 46
5 3TC+AZT+DDC+IDV 7
6 D4T+DDI+NFV 30
7 3TC+DDI+NFV 18

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, N88S   L10V, I13V, E35D, N37D, I62V, L63P, I64V, A71T, I72V, V77I, I93L  
>CA3778| codons 1-99
PQITLWQRPVVTVKIGGQLKEALLDTGADDTVLEDMDLPGRWKPKIIGGIGGFIKVRQYD
QVPVEICGHKTVGTVLIGPTPVNIIGRSLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, Q151M, M184V       K20R, K104KN, I135T, T200A, R211K, T286A, A288T, I293V, E297K Q145QP
>CA3777| codons 1-302
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKNSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYPYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKTLTEVVPLTKEAE
LE

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005