<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1410 CA37774 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+DDC+DLV+NFV 26
2 D4T+DLV+NFV 24
3 3TC+D4T+IDV+NFV 118
4 3TC+ABC+APV+IDV+RTV 133

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V T215V, K219Q   V179D K20R, V35M, E40EQ, K43N, K103R, V118I, S162A, G196E, Q207E, F214L, L228H, I244V  
>CA37774| codons 1-247
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICTQLENEGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIDI
YQYVDDLYVGSDLEIEQHRTKIEELREHLLRWGLVTPDQKHQKEPPFHWMGYELHPDKWT
VQPVVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   L10I, I62V, L63P, I72L, V77I, I93L  
>CA37773| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKALGTVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012