<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4565 CA37765 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 3TC+D4T+SQV 80
3 D4T+DDI+NFV 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R T215I, K219Q     K20KR, S48T, T69S, K122E, I135T, Q197E, F214L, V245K  
>CA37765| codons 1-249
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKITKIGPENPYNTPV
FAIKKKNSSRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGEHRTKIEELRQHLLRWGLITPDQKHQKEPPFLWMGYELHPDKWT
VQPIKLPEK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88ND I13V, I62V, L63P, I64V, T74A  
>CA11216| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADNTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPVEICGHKAIGAVLVGPTPVNIIGRDLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005