<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5951 CA37761 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 113
2 3TC+AZT 9
3 3TC+AZT+IDV 52
4 3TC+D4T+NVP 57
5 None 187
6 3TC+ABC+D4T+LPV 26
7 None 12
8 3TC+ABC+D4T+LPV 21

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46ML, I47A   L10LI, T12PS, L19I, E35D, M36I, R41RK, Q61QH, L63P, I64V, A71AV, I93L  
>CA37761| codons 1-99
PQITLWQRPIVSIKIGGQIKEALLDTGADDTILEDINLPGKWKPKLAGGIGGFIKVRQYD
HIPVEICGHKVIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210LW, T215Y   K103KNRS, G190GA   K32N, V35K, T39A, R83K, K173Q, Q174QK, I178IM, E203EK, Q207QR, R211Q, A272P, R284RK, T286A, A288AT  
>CA37762| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKINALKEICAELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKSKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRQKNPDMVI
YQYVDDLYVASDLEIGQHRTKIKELRRHLWQWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLKGAKTLTEVIPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005