<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1337 CA37752 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T 31
2 3TC+D4T+RTV 12
3 3TC+D4T+IDV 41
4 AZT+DDI+NFV 34
5 3TC+AZT+RTV+SQV 3
6 3TC+AZT+NFV+SQV 20
7 3TC+ABC+AZT+ADV+EFV+NFV+SQV 19
8 Unknown NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54V, V82A, L90M L33F, F53L, G73GS I13V, I15V, L19I, K20M, E35D, M36I, L63P, A71V  
>CA37752| codons 1-99
PQITLWQRPLVTVKVGGQIMEALLDTGADDTIFEDINLPGRWKPKIVGGIGGLVKVRQYD
QIPIEICGHKVISTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V   K103N   V35MT, K122E, D123NS, I135T, I142V, I178IM, A272P, A288S  
>CA37753| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKSLTEVIPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005