<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7101 CA37747 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 139
2 3TC+AZT+RTV+SQV 299

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       K43E, E44A, V118I, D121Y, K122E, I135T, S162C, G196E, E203K, Q207E, H208Y, R211K, K223Q, L228HR, A272P, T286A, E297P I167M
>CA37747| codons 1-299
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEEAGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
YEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKMLEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIKELREYLWKWGFYTPDKKHQQEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTPEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48T, I54V, V82A, I84V L24I L10I, I13V, G16E, K20I, L63T, I72T, T74S, V77I, L89M, T91A  
>CA37746| codons 1-99
PQITLWQRPIVTVKIEGQLIEALIDTGADDTVLEEMNLPGRWKPKLITGIGGFVKVRQYD
QITIEICGHKATGSVLIGPTPANVIGRNMLAQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005