<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8001 CA37734 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 3TC+AZT 26
3 3TC+AZT+IDV 261
4 3TC+AZT+LPV+NVP 112

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, V82VA, L90M L10F, F53L L19I, K20T, M36I, L63P, I64V, A71AV, I72V, I93IL  
>CA37734| codons 1-99
PQITLWQRPFVTIKIGGQITEALLDTGADDTILEEINLPGRWKPKIVGGIGGLIKVRQYD
QIPVEICGHKVVGTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184V T215V, K219Q K103N   P4PS, E6D, E28EGKR, K101KQ, T200I, I202V, E203Q, Q207D, T286A, I293IV, E297A  
>CA37735| codons 1-300
PISSIDTVPVKLKPGMDGPKVKQWPLTREKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRIKVQELRDHLLRWGFVTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLTAEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005