<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5244 CA37731 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 131
2 D4T+EFV+NFV 70
3 3TC+DDI+IDV+RTV 69
4 None 52
5 3TC+DDI+IDV+RTV 72

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, T215Y       P4S, K20R, A98S, K102Q, D123E, K166R, D177E, H208Y, R211K, V245K, K277R, R284K, T286A, E297K  
>CA37731| codons 1-300
PISSIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPSGLKQKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQYLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLKGAKALTEVIPLTKEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M L33LI, N88D L10I, I13V, L63P, A71V, I72IL, V77I, I85V  
>CA37730| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVIEEMNLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKVLGTVLIGPTPVNVVGRDLMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005