<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3920 CA37720 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 72
2 AZT+DDC 134
3 3TC+D4T 36
4 3TC+AZT+IDV 16
5 3TC+AZT+NFV 46
6 NVP+3TC+D4T+NFV 62
7 ABC+DDI+RTV+SQV 34
8 Unknown 10

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33F N37CS, P39PS, I62V, I64V, V77I  
>CA37720| codons 7-98
QRPLVTIKIGGQLKEALLDTGADDTVFEEMSLSGRWKPKMIGGIGGFIKVRQYDQVLVEI
CGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219Q     V35M, K104N, K166R, G196E, H208Y, R211K, D218E, V245T, E248D, D250E, A272P, R284RK, T286A, E297K, D324E, Q334E, M357T, G359GS, K366R, A371AV, I375IV, A376T, K390R, A400T, V417VI, V435E, K451R, L452S, D460N, T470N, K476KR, K512R, S519N Q197T, L551LS
>CA37721| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKNSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIETHRTKIEELRQYLLKWGFFTPEQKHQKEPPFLWMGYELHPDKWT
VQPITLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLKGAKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGEGQWTYQIYQEPFKNLKTGKYARTRSA
HTNDVRQLTEVVQKVTTESIVIWGKTPKFRLPIQKETWETWWTEYWQATWIPEWEFINTP
PLVKLWYQLEKEPIEGAETFYVDGAANRETRSGKAGYVTNRGRQKVVSLNDTTNQRTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDRSESELVNQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKSVSAGIRKVL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005