<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7917 CA37714 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 104
2 3TC+AZT+SQV 61
3 3TC+AZT+D4T+IDV 48
4 D4T+DDI+NVP+RTV+SQV 8
5 D4T+DDI+IDV+RTV 48
6 APV+D4T+DDI+EFV 57
7 APV+D4T+DDI+RTV 144

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I47V, G48V, I54M, V82A, L90M   L10I, T12S, I13V, G16A, Q18H, K20I, L63P, A71IV, I85V, I93L  
>CA37714| codons 1-99
PQITLWQRPIVSVKIAGHLIEALLDTGADDTVLEEMNLPGRWKPKMVVGIGGFMKVRQYD
QIPIEICGHKVIGTVLVGPTPANIVGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, Q151M F116Y, K219Q     T39TA, V60I, V118I, K122E, I135T, T139I, K166Q, G196E, T200I, F214L, L228H, A272P, E291D  
>CA37715| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAEMEKEGKISKIGPENPYNTPI
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYYSIPL
DEDFRKYTAFTIPSTNNEIPGIRYQYNVLPMGWKGSPAIFQSSMTQILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRIKIEELRQHLLRWGLTTPDQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDVIPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005