<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3899 CA37703 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T 164
2 D4T+DDI 23
3 D4T+DDI+EFV 34
4 3TC+D4T+EFV 52
5 ABC+D4T+DDI+NFV 13
6 D4T+DDI+NFV 83
7 3TC+DDI+EFV 20

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y   K103N A98G, V179E V35R, V60I, K122E, I135L, Q207E, R211K, A272P, T286A, I293V, T296S, E297A  
>CA37703| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALREICTELEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIEI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVVPLSAEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L63T, A71V, I72T, V77I, I93L  
>CA37702| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QITIEICGHKVTGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005