<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6426 CA37700 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDC 61
2 D4T 35
3 3TC+D4T 17
4 3TC+D4T+IDV 57
5 3TC+D4T+NFV+NVP 35
6 3TC+D4T+NFV 61
7 ABC+RTV+SQV 74
8 D4T+EFV+LPV 52
9 3TC+APV+D4T+RTV+TDF 61
10 None 22
11 DDI+LPV+T20+TDF 12

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54IV, I84IV, L90M L10F, G73GISV I13V, K20I, M36MI, I62IV, L63P, T74TS, L89MT  
>CA37700| codons 1-99
PQITLWQRPFVTVKIGGQLIEALLDTGADDTVLEEINLPGRWKPKIIGGIGGFVKVRQYD
QVPIEICGHKAIVSVLVGPTPVNVIGRNTMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67DN, K70KR, M184MV, T215Y K219Q     K20R, V35I, K64KR, K122KE, I135T, D177E, H208HY, R211RK, F214FL, D218DE, I257L, A272P, A288S, I293V  
>CA37701| codons 1-299
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIRKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQYLLKWGLYTPEQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDLQKLVGKLNWASQIYPGIKVKQLCKLLRGTKSLTEVVPLTEEA

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005