<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6555 CA37698 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NFV 57
2 None 26
3 D4T+DDI+NVP 87
4 None 21
5 3TC+DDI+TDF 37

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14M, K43R, I62V, L63S, E65D, A71V, I72T, V77I, I93L  
>CA37698| codons 1-99
PQITLWQRPLVTIMIGGQLKEALLDTGADDTVLEEMNLPGRWRPKMIGGIGGFIKVRQYD
QVSIDICGHKVTGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, M184V T215S     K20KR, S68G, D123E, I135T, S162A, D177E, I178M, Q207N, R211K, S251N, A272P, K277R, T286A, V292I, I293V, Q334L, G359S, A371V, I375V, A400T, D460N, R461K, T470N, L491S, V496I, K512KQ, S519N, A554AT  
>CA37699| codons 1-560
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKRKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPEMVI
YQYVDDLYVGSDLEIGQHRTKIEELRNHLLKWGFSTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDNWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGLGQWTYQIYQEPFKNLKTGKYARMRSA
HTNDVKQLTEVVQKVATESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVSLNDTTNQKTELQ
AIHLALQDSGSEVNIITDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSTGIRKVL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005