<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8394 CA37694 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 70
2 3TC+DDI+IDV 88

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I84C, L90M L10F, L89V I13V, G16E, Q18QH, K20I, M36I, I62V, L63H, A71T, C95CF  
>CA37694| codons 1-99
PQITLWQRPFVTVKIEGHLIEALLDTGADDTVLEEINLPGRWKPKLIGGIGGFIKVRQYD
QVHIEICGHKTIGTVLVGPTPVNCIGRNVMTQIGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W T215C, K219N K103H, Y181C, G190A K101N V35L, E44ED, K102Q, V118I, K122E, I135V, I202IV, H208Y, R211K, F214FL  
>CA37695| codons 1-247
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICTELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLNQHKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYVDDLYVASDLEIGQHRTKVEELRQYLWKWGLCTPDNKHQKEPPFLWMGYELHPDKWT
VQPIVLP

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005