<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2256 CA37686 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 29
2 AZT+DDC 78
3 3TC+AZT+SQV 8
4 AZT 17
5 3TC+AZT+RTV 9
6 3TC+AZT 51
7 D4T+IDV 16
8 D4T+IDV+RTV 54
9 D4T+DDI+RTV+SQV 33
10 D4T+DDI+EFV+RTV+SQV 13
11 Unknown 179

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I54V, V82T, L90M G73S L10I, I15V, K20R, M36I, N37D, L63P, A71V, I85V  
>CA37686| codons 1-99
PQITLWQRPIVTIKVGGQLREALLDTGADDTILEEIDLPGRWKPKMIGGIGGFVKVRQYD
QIPIEICGHKVISTVLVGPTPTNIVGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y   K103N   V35I, K43N, R83K, K122E, G196E, T200A, Q207E, R211K, L228R, V245E, A272P, K277R, Q278H, T286A, E297R Q269H
>CA37687| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELENEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRAKIEELREHLWKWGFYTPDKKHQKEPPFRWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASHIYPGIKVRHLCKLLRGAKALTEVIPLTREAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005