<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1267 CA37680 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI NA
2 D4T+ 3TC 23
3 SQV+ D4T+ 3TC 25
4 SQV+ D4T+ ADV+ 3TC 54
5 D4T+ 3TC+ RTV+ SQV 75
6 ABC+ D4T+ DDI 119
7 AZT+ EFV+ TDF 57
8 Unknown 17

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   L10V, I13V, K14R, L19I, L63P, I64V  
>CA37680| codons 1-99
PQITLWQRPVVTVRIGGQIKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPVEICGHKAIGTVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y   K103N   K20R, K43N, V60I, K104N, K122E, D123N, I135T, I142V, S162Y, I178L, T200A, Q207E, I293V  
>CA37681| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELENEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNNSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDLVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLWRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005