<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1819 CA37678 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 70
2 3TC+AZT+IDV 113
3 D4T+EFV+RTV+SQV 85
4 3TC+APV+RTV+SQV 154

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, I84V V11I, L24I L10I, I15V, A22V, E34D, M36I, I62V, L63P, A71V T91TCS
>CA37678| codons 1-99
PQITLWQRPIITIKVGGQLKEVLIDTGADDTVLDEINLPGRWKPKMIGGIGGFVKVRQYD
QVPIEICGHKVIGTVLVGPTPANVIGRNLLSQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, M184V T215C, K219E K103N   K122KE, V245E, R284K, I293V  
>CA37679| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFCTPDEKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGTKALTEVVPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009