<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1601 CA37656 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 SQV+ DDC+ AZT 17
2 IDV+ D4T+ 3TC 87
3 EFV+ DDI+ ADV 35
4 ABC+ D4T+ RTV+ IDV 130
5 TDF+ LPV+ DDI 29
6 Unknown 20

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L10F, G73T I13IM, K20I, M36MI, N37D, I62V, L63P, C67F, A71T, I72T, I93L  
>CA37656| codons 1-99
PQITLWQRPFVTMKIGGQLIEALLDTGADDTVLEEIDLPGRWKPKIIGGIGGFVKVRQYD
QVPIEIFGHKTTTTVLVGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DGNS, T69TADN, L210W, T215Y K219R     K20KR, V35M, T39A, K43Q, E44D, V60VI, V118I, K122E, G196E, T200A, E203D, L205F, Q207E, H208Y, R211K, D218E, D250DE, A272P, K281R, E297R I293IMV
>CA37657| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICAELEQDGKISKIGPENPYNTPI
FAIKKKSSNKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRAKIDEFREYLWKWGFYTPERKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGTKALTEVVPLTREAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005